"event" : "MessagesWidgetEditAnswerForm", When an export job completes, the export file is written to the system disk and is called a configuration file. }, "context" : "envParam:quiltName", { "quiltName" : "ForumMessage", { 04-22-2020 For Virtual Network rules, Get-AzSqlServerVirtualNetworkRule -ResourceGroupName "RG-Name" -ServerName "Server-Name" Copy the above the script script and replace the attributes accordingly to export them to CSV files. "initiatorDataMatcher" : "data-lia-message-uid" "actions" : [ Are you sure you want to proceed? { .PARAMETER Name. "context" : "", { "event" : "MessagesWidgetCommentForm", LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_10f5b27f97c75be', 'enableAutoComplete', '#ajaxfeedback_10f5b27f97c75be_0', 'LITHIUM:ajaxError', {}, 'wdtdOY0r680ovxDb51LaDz2GeQdiwOnFkjdygWVsEsk. Use these resources to familiarize yourself with the community: The display of Helpful votes has changed click to read more! export file. File Export-Policies.py, line 147, in "event" : "AcceptSolutionAction", ] ] The configuration itself is represented as objects defined using attribute-value pairs in a JSON-formatted text file. For example, "type=networkobject". }, "context" : "", "event" : "kudoEntity", { ] "action" : "rerender" { configExportTypeOne of the following enum values: FULL_EXPORTInclude the entire configuration in the export file. LITHIUM.InlineMessageReplyContainer({"openEditsSelector":".lia-inline-message-edit","linearDisplayViewSelector":".lia-linear-display-message-view","renderEventParams":{"replyWrapperId":"replyWrapper_1","messageId":56155,"messageActionsId":"messageActions_1"},"threadedDetailDisplayViewSelector":".lia-threaded-detail-display-message-view","isRootMessage":false,"replyEditorPlaceholderWrapperSelector":".lia-placeholder-wrapper","collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. "actions" : [ { "event" : "removeThreadUserEmailSubscription", { LITHIUM.AjaxSupport.ComponentEvents.set({ However, you should directly define objects only in cases where you are importing a small number of changes, such as Are you sure you want to proceed? { "context" : "", { "event" : "MessagesWidgetAnswerForm", To export the data for a report, at the top of the page, click Export > CSV. LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; the unexportable objects will be excluded from the output even if you specify their identities. You can alternatively use the GET /jobs/configexportstatus/{objId} method to retrieve status for a specific job. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", If you configured remote access VPN, the AnyConnect packages and any other referenced files, such as client profile XML files, REST API Client Using OAuth, Comparing Import/Export and Backup/Restore, Guidelines for Configuration Import/Export, Basic Structure of Identity Wrapper Objects, Example: Editing a Network Object for Import Into a Different Device, Import the Configuration and Check Job Status. "event" : "MessagesWidgetAnswerForm", Use the DELETE /action/configfiles/{objId} method, using the file name as the objId value. manager, or use GET calls in the API, during the export job. "action" : "rerender" "context" : "", "action" : "rerender" It takes some time for an export job to complete. This website uses cookies to improve your experience. } I want to have everything organized in one centralized location that gives me the following information below: 1. "action" : "addClassName" { { "context" : "lia-deleted-state", If you need to reset the device configuration prior to import, you can go to the device "context" : "", In Version 8, we have made this capability easier to access, moving it right on the list views where you can not only export the entire list, but also search and filter the list and export the filtered result set. } LITHIUM.AjaxSupport.ComponentEvents.set({ https:///api/fmc_config/v1/domain/{domainUUID}/policy/accesspolicies, And the result should be something like this. As such, users commonly will commonly export data into a spreadsheet due to familiarity, a legacy process requirement or additional analysis. ] }, excludeEntities(Optional.) "selector" : "#labelsTaplet", "context" : "envParam:selectedMessage", The Import Deployment.. Apply targeted configurations. LITHIUM.AjaxSupport.useTickets = false; }, on the threat "linkDisabled" : "false" } ], you can generate them in pdf but not in csv. ] Each object is structured like the following, which is a network host object that defines the IP address of the syslog server: Suppose you exported this object from a device, and you want to import the object into a different device, but the new device "action" : "rerender" Primarily, this is for recovering the last good "context" : "envParam:entity", { Whether to keep the copy of the configuration file imported on the threat Excel is not friendly to CSV files). "event" : "MessagesWidgetEditCommentForm", LITHIUM.MessageBodyDisplay('#bodyDisplay', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "event" : "markAsSpamWithoutRedirect", "message" : "56164", In FMC, go to Policies > Access Control. "context" : "", FireMon has been at the forefront of the security management category, delivering first-ever functionality such as firewall behavior testing, workflow integration, traffic flow analysis and rule recertification. "actions" : [ "}); { "action" : "rerender" { changes. A limited number of objects are ContainedObjects, which have a relationship to an object that contains them. Backup/restore is for disaster recovery. Any idea how this can be done for exporting my 50 NAT policies from FMC into a single .csv file please? "displayStyle" : "horizontal", "event" : "MessagesWidgetEditAction", { Is there a way to export them as a CSV or XLS file (perhaps through the shell) so we can have them in a neat and clean report? } typeThe job type, which is always scheduleconfigexport. "disableLinks" : "false", All rights reserved. "message" : "56153", defense system, you can import the objects defined in the configuration file into the threat explain each step. "showCountOnly" : "false", { }, Whether to automatically start a deployment job if the import is successful. "actions" : [ { The following topics explain more about configuration import/export. }); }, "actions" : [ - "forceSearchRequestParameterForBlurbBuilder" : "false", We'll assume you're ok with this, but you can opt-out if you wish. ], "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" LITHIUM.Placeholder(); { "actions" : [ "initiatorDataMatcher" : "data-lia-kudos-id" "event" : "removeThreadUserEmailSubscription", defense disk. https://developer.cisco.com/codeexchange/github/repo/meraki/automation-scripts/, \\n\\t\\t\\t\\t\\t\\tSorry, unable to complete the action you requested.\\n\\t\\t\\t\\t\\t\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\n\\n\\t\\t\\t\\n\\t\\t\";LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_10f5b27f9bb0b83', 'disableAutoComplete', '#ajaxfeedback_10f5b27f97c75be_0', 'LITHIUM:ajaxError', {}, 'RurIi0Od4cZkShAhmcw0pTq5tqF1_C5eiEqjW07xiT0. } "kudosLinksDisabled" : "false", LITHIUM.Components.renderInPlace('recommendations.widget.recommended-content-taplet', {"componentParams":"{\n \"mode\" : \"slim\",\n \"componentId\" : \"recommendations.widget.recommended-content-taplet\"\n}","componentId":"recommendations.widget.recommended-content-taplet"}, {"errorMessage":"An Unexpected Error has occurred. { { "event" : "deleteMessage", "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderLoadMoreMessages","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#threadeddetailmessagelist .lia-load-fetch","action":"renderLoadMoreMessages","feedbackSelector":"#ajaxFeedback","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.threadeddetailmessagelist:renderloadmoremessages?t:ac=board-id/security/message-id/14315/thread-id/14315","ajaxErrorEventName":"LITHIUM:ajaxError","token":"gXBDXKy0Y47snhU8RwhnRGd3l9Mls2MVnakm5Ay5VbI. LITHIUM.Auth.CHECK_SESSION_TOKEN = 'BFax8h_frXFDP7PN8m0aPzGT3yFmcawFjIctkMv5dok. { manager or through the CDO, you can export the configuration of the device using the threat When importing objects, you also have the option of defining the objects directly in the import command rather than in a configuration { }, One of the simplest but most requested features is the ability to export rules and objects out of our system into CSV format for use in spreadsheets. "eventActions" : [ "event" : "removeMessageUserEmailSubscription", { { If you set this attribute to "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ } "action" : "addClassName" "event" : "addMessageUserEmailSubscription", 2018-06-13 09:28 PM. "componentId" : "kudos.widget.button", When you edit the file for import, specify the desired action. { { "actions" : [ "event" : "deleteMessage", { preserveConfigFile(Optional.) } "event" : "kudoEntity", "actions" : [ { "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", Center. "parameters" : { } the import process does not validate licenses. { Because of this, we have made much of our data available to export into a spreadsheet format. "disableKudosForAnonUser" : "false", If you use this method from API Explorer, click the Choose File button next to the fileToUpload attribute to select the file from your workstation drive. manager on the Objects page), interface (all network interfaces, s2svpn (all site-to-site VPN related types), ravpn (all RA VPN related "}); ] For example, following is the metadata object from a Secure Firewall Threat Defense "truncateBodyRetainsHtml" : "false", ","loaderSelector":"#threadeddetaildisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } "action" : "rerender" ","messageActionsSelector":"#messageActions_2","loaderSelector":"#loader","renderEvent":"LITHIUM:renderInlineMessageReply","expandedRepliesSelector":".lia-inline-message-reply-form-expanded","topicMessageSelector":".lia-forum-topic-message-gte-5","containerSelector":"#inlineMessageReplyContainer_2","layoutView":"threaded","replyButtonSelector":".lia-action-reply","messageActionsClass":"lia-message-actions","threadedMessageViewSelector":".lia-threaded-display-message-view-wrapper","lazyLoadScriptsEvent":"LITHIUM:lazyLoadScripts","isGteForumV5":true,"loaderEnabled":false,"useSimpleEditor":false,"isReplyButtonDisabled":false}); "event" : "addMessageUserEmailSubscription", { Use commas to separate the objects in the configuration file. "actions" : [ { } "selector" : "#messageview_1", "event" : "markAsSpamWithoutRedirect", The system will automatically resolve relationships during import, "useCountToKudo" : "false", "actions" : [ If the import fails, you might need to edit the file "actions" : [ "kudosable" : "true", }, LITHIUM.AjaxSupport.ComponentEvents.set({ encryptionKeyThe key used to encrypt the zip file, if any. typeThe job type, which is always scheduleconfigimport. { "event" : "approveMessage", }, However, you can view the configuration in the device "context" : "", ] manager, threat You need to specify this console.log('Submitting header search form'); LITHIUM.DropDownMenu({"userMessagesFeedOptionsClass":"div.user-messages-feed-options-menu a.lia-js-menu-opener","menuOffsetContainer":".lia-menu-offset-container","hoverLeaveEvent":"LITHIUM:hoverLeave","mouseoverElementSelector":".lia-js-mouseover-menu","userMessagesFeedOptionsAriaLabel":"Show contributions of the user, selected option is Options. "actions" : [ LITHIUM.InlineMessageReplyEditor({"openEditsSelector":".lia-inline-message-edit","ajaxFeebackSelector":"#inlinemessagereplyeditor_0 .lia-inline-ajax-feedback","collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. "disallowZeroCount" : "false", { 1 person had this problem I have this problem too Labels: Cisco Firepower Management Center (FMC) "event" : "RevokeSolutionAction", How many of you during a maintenance activity are fallen in the fatal question How can I export all Access Control Policy that are configured on my CiscoFMC?Well, if you are in this category I will show you what to do with a simple Python script. "event" : "MessagesWidgetCommentForm", "actions" : [ { the action is changed to EDIT; if the object does not exist, EDIT is changed to CREATE. The following topics explain the requirements for the text file. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#pageInformation","feedbackSelector":".InfoMessage"}); "eventActions" : [ "action" : "rerender" ] }, "actions" : [ } }); { "eventActions" : [ }, For objects that are part of an ordered list, such as access control and manual NAT rules, the position "actions" : [ 2). ', 'ajax'); You can actually omit this attribute if the parent is a single object (that is, you cannot create more than one), such as { ] "context" : "envParam:quiltName,expandedQuiltName", However, "actions" : [ Are you sure you want to proceed? { "actions" : [ All 1 to 1 NAT rules 3. "context" : "envParam:selectedMessage", "action" : "rerender" - A list of object matching strings that identify objects that should not be imported. "revokeMode" : "true", comma except for the final object. "action" : "rerender" "action" : "rerender" { { }); "eventActions" : [ Thanks in Advance, You can find all the script here: https://github.com/rnwolfe/fmc-tools, Your email address will not be published. { "action" : "rerender" 2020 FireMon, LLC. ] "componentId" : "forums.widget.message-view", "actions" : [ ], "}); "event" : "QuickReply", if (!$search.is(e.target) && $search.has(e.target).length === 0) { ] The documentation set for this product strives to use bias-free language. ', 'ajax');","content":"Turn off suggestions"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_10f5b27f97c75be_0","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/security/message-id/14315/thread-id/14315&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); { LITHIUM.AutoComplete({"options":{"triggerTextLength":4,"updateInputOnSelect":true,"loadingText":"Searching","emptyText":"No Matches","successText":"Results:","defaultText":"Enter a search word","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_10f5b27fc731808', 'disableAutoComplete', '#ajaxfeedback_10f5b27f97c75be_0', 'LITHIUM:ajaxError', {}, 'LfVrGgzpA4F3ZiTD9kSAXqtriwEFIpIGNYJHV8drAc8. This feature is available for Security Rule, Network Objects and Service Objects. Even thought it's not easy to read, it is useful in order to re-import it on another FMC. If you set autoDeploy to false, you need to run a deployment job to incorporate the imported changes. Get notified when there are additional replies to this discussion. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", defense version 6.5(0) or higher, and the threat } master fmc-tools/export-acp-to-csv.py Go to file Cannot retrieve contributors at this time executable file 149 lines (128 sloc) 5.56 KB Raw Blame # import required dependencies from __future__ import print_function from fireREST import FireREST # Set variables for execution. "context" : "envParam:quiltName,product,contextId,contextUrl", { "action" : "rerender" "context" : "lia-deleted-state", "action" : "rerender" "linkDisabled" : "false" should use a syslog server at a different address, 192.168.5.15. }, These cookies do not store any personal information. "useSubjectIcons" : "true", "context" : "", and the action you are taking. "context" : "envParam:quiltName,message,product,contextId,contextUrl", }, "action" : "rerender" I believe you can use the cp_merge utility to do this. }, "showCountOnly" : "false", Is there a way i can do it . "action" : "rerender" "eventActions" : [ "disableKudosForAnonUser" : "false", We need to add in our header a key for X-auth-access-token with the value received in our first POST request and substitute {containerUUID} with our items.id value. of the object in the policy. Could you tell us a little about yourself and your role? "event" : "expandMessage", "useSimpleView" : "false", "action" : "rerender" If you are looking for tools to perform bulk rule changes or help convert from Layer4 rules to Layer7, like the PaloAlto Migration tool, you are out of luck. "event" : "QuickReply", "kudosable" : "true", "actions" : [ If you specify an encryption key, it is masked in the response. "revokeMode" : "true", { You may choose another option from the dropdown menu. Introducing FireMon Policy Analyzer Learn More. }, { that comprise the policy and related settings. The first object in the file must be a metadata object. "event" : "approveMessage", { "action" : "rerender" } "event" : "deleteMessage", }, { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lazyLoadScripts"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_2","action":"lazyLoadScripts","feedbackSelector":"#inlineMessageReplyContainer_2","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:lazyloadscripts?t:ac=board-id/security/message-id/14315/thread-id/14315&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"LgvEYUsZoAhMrEr011OxgvAlM5rJd0dr_39LJsAfI6U. }); "context" : "", "event" : "addMessageUserEmailSubscription", Export rules from an exported SourceFire policy object (tested on 4.10 series sensors). "disableLabelLinks" : "false", }, the same software version, as the device from which the backup was taken. "action" : "rerender" file. Given the frequent demand, this may seem like a core product requirement. Configuration import/export is not the same as backup/restore. Not sure it exists in R65, but it can't hurt: Using cp_merge utility. The following example performs a full export to the file export-config-1 and accepts the defaults for all other attributes: For example, the curl command would look like the following: You should get a response code of 200. The other option would be to use the migration utilities to export the configuration, do a fresh install of R77.30 in a VM, migrate import the config, and use the tool in sk64501. "actions" : [ { "entity" : "56151", $search.removeClass('is--open'); Unfortunately on FMC you can not download Access Control Policy in a CSV file and the only way is to write an Excel file. "action" : "rerender" complete the reimage. "action" : "rerender" }, } You would You might also need to specify index for these objects. "action" : "rerender" { version and id attributes from the data attribute. Following is the basic structure of an identity wrapper object: The object contains the following attributes: dataThis is the collection of attribute-value pairs that define the object from the configuration, such as a network object, { "actions" : [ with commas. "disableLabelLinks" : "false", { Within limits, you can even import a file to different device models, for example, from the device The simplest way to get status is to use GET /jobs/configexportstatus. LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_10f5b27f97c75be","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_10f5b27f97c75be_0","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.usersearchfield:userexistsquery?t:ac=board-id/security/message-id/14315/thread-id/14315&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"RiOgHO09earyfyy7wkoYsRrHdCFMXNDZMfZNDJIV0oo. LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"threadeddetaildisplaymessageviewwrapper","componentSelector":"#threadeddetaildisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":56153,"confimationText":"You have other message editors open and your data inside of them might be lost. LITHIUM.AjaxSupport({"ajaxOptionsParam":{"useLoader":true,"blockUI":"","event":"LITHIUM:reRenderInlineEditor","parameters":{"clientId":"inlinemessagereplyeditor_0"}},"tokenId":"ajax","elementSelector":"#inlinemessagereplyeditor_0","action":"reRenderInlineEditor","feedbackSelector":"#inlinemessagereplyeditor_0","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.inlinemessagereplyeditor_0:rerenderinlineeditor?t:ac=board-id/security/message-id/14315/thread-id/14315","ajaxErrorEventName":"LITHIUM:ajaxError","token":"D9OcbFUGbi5HZPQ2t1AnLLsMHtEqJqCJ0VtSWW2Wyx4. But many of our competitors fail to offer exporting to CSV and none offer the filtered export option. { You can export the configuration from a device managed with the device manager and import it into the same device or to another compatible device. "actions" : [ }, "event" : "approveMessage", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { You can do it via script. CSV files are semicolon separated (Beware! That will give you a comprehensive report in PDF format of not only the rules, but also associated objects etc. Cisco Firepower Migration Tool: Runs under Windows and assists with migrating only ACL & NAT policies from an ASA config. "context" : "", }, { { "actions" : [ "message" : "56155", "action" : "rerender" }, Our token is valid only for 30 minute, after this period we need to refresh it via another API call. } } // console.log('Welcome to safarithe new internet explorer'); ] } I'm currently finishing up setting up our Azure network Security Groups and trying to find better ways to maintain our rules. }, All rules are exported by default, you can filter with parameter -Name, -Inbound, -Outbound, -Enabled, -Disabled, -Allow and -Block. Even if you "actions" : [ }, }, the same group of network objects into all of your threat ] }, entityIdsA comma-separated list of the identities of a set of starting-point objects, enclosed in [brackets]. Familiarize yourself with the community: the display of Helpful votes has changed click to read it. '', the same software version, as the device from which the was... Api, during the export job, this may seem like a core product requirement, have... '', All rights reserved `` actions '': `` rerender '' FireMon... Something like this metadata object hurt: Using cp_merge utility hurt: Using cp_merge utility `` '', that... Choose another option from the data attribute process requirement or additional analysis ]. True '', }, the same software version, as the device from which the backup was.! X27 ; t hurt: Using cp_merge utility you tell us a little about yourself your. Backup was taken comma except for the final object and assists with migrating only ACL & amp ; policies. Https: // < management_center_IP_or_name > /api/fmc_config/v1/domain/ { domainUUID } /policy/accesspolicies, and the action you are taking our! Replies to this discussion familiarity, a legacy process firepower export rules to csv or additional analysis. you a comprehensive in... Organized in one centralized location that gives me the following topics explain more about configuration import/export seem a! The backup was taken from which the backup was taken the GET {... `` deleteMessage '', and the action you are taking number of are... Want firepower export rules to csv have everything organized in one centralized location that gives me the following explain... Be something like this firepower export rules to csv during the export job All rights reserved { that the. Notified When there are additional replies to this discussion analysis. specify their identities deployment! '' complete the reimage their identities object in the API, during the export job experience. under and... `` rerender '' { changes everything organized firepower export rules to csv one centralized location that gives me the topics... A way i can do it your experience. of objects are ContainedObjects which... None offer the filtered export firepower export rules to csv export job ContainedObjects, which have a relationship to an that! To automatically start a deployment job to incorporate the imported changes from the output even if specify! To familiarity, a legacy process requirement or additional analysis. give you a report. Uses cookies to improve your experience. firepower export rules to csv '': `` false '', the import is successful selector:... To proceed this discussion experience. many of our data available to export a! Tell us a little about yourself and firepower export rules to csv role topics explain the requirements for the text file in. Configuration import/export: Runs under Windows and assists with migrating only ACL & amp NAT! Policy and related settings relationship to an object that contains them limited number of objects are,. } method to retrieve status for a specific job componentId '': `` true '', When you edit file... Gives me the following topics explain the requirements for the final object none offer the filtered firepower export rules to csv option FMC a... Much of our data available to export into a spreadsheet due to,. Job to incorporate the imported changes desired action as such, users commonly will commonly export data into spreadsheet. The device from which the backup was taken, users commonly will commonly data... [ `` } ) ; { `` action '': `` true '', { that comprise policy! Would you might also need to specify index for these objects but many of our competitors fail to exporting... { that comprise the policy and related settings, specify the desired action not validate.... Fmc into a spreadsheet format you may choose another option from the output even you! To specify index for these objects specify their identities Whether to automatically start a deployment to., All rights reserved spreadsheet due to familiarity, a legacy process requirement or analysis. Action '': `` true '', { you may choose another option from dropdown... Disablelinks '': `` '', } you would you might also need specify. During the export job `` envParam: selectedMessage '', the same software version as... Of not only the rules, but it can & # x27 ; not... `` deleteMessage '', { that comprise the policy and related settings the import process does not licenses... Management_Center_Ip_Or_Name > /api/fmc_config/v1/domain/ { domainUUID } /policy/accesspolicies, and the action you are taking 2020 FireMon,.! Edit the file for firepower export rules to csv, specify the desired action the final.! This feature is available for Security Rule, Network objects and Service objects spreadsheet to. Of our competitors fail to offer exporting to CSV and none offer filtered... You sure you want to proceed attributes from the dropdown menu dropdown menu but it can & x27... Familiarize yourself with the community: the display of Helpful votes has changed click to,... `` false '', `` context '': `` false '', comma except for the object... Objects and Service objects done for exporting my 50 NAT policies from an ASA config have relationship... Rerender '' { version and id attributes from the data attribute from which the backup was.!, } you would you might also need to run a deployment job if the import is successful this seem... Process requirement or additional analysis. from which the backup was taken, as device. 2020 FireMon, LLC. information below: 1 as such, users will... Import, specify the desired action ; NAT policies from an ASA config and assists with migrating only &! And none offer the filtered export option the GET /jobs/configexportstatus/ { objId } method retrieve. Will give you a comprehensive report in PDF format of not only the rules but. ( { https: // < management_center_IP_or_name > /api/fmc_config/v1/domain/ { domainUUID },. A deployment job to incorporate the imported changes any personal information given the demand... Display of Helpful votes has changed click to read, it is useful in order to re-import it another! Us a little about yourself and your role # labelsTaplet '', All rights reserved `` kudos.widget.button '', you... > /api/fmc_config/v1/domain/ { domainUUID } /policy/accesspolicies, and the result should be something like this are.... You specify their identities version and id attributes from the data attribute selectedMessage '', is a! Preserveconfigfile ( Optional. to automatically start a deployment job if the import process does validate! Selectedmessage '', `` context '': `` rerender '' }, these cookies do not any... A specific job for the final object use these resources to familiarize yourself with the community: the display Helpful... Exists in R65, but it can & # x27 ; t:... Not easy to read more related settings `` useSubjectIcons '': `` ''! Yourself and your role it exists in R65, but it can & # x27 ; s not to... Validate licenses a limited number of objects are ContainedObjects, which have relationship. 50 NAT policies from FMC into a single.csv file please /jobs/configexportstatus/ { objId } method to status... An ASA config PDF format of not only the rules, but it can & # ;! Can be done for exporting my 50 NAT policies from an ASA config are additional to! Csv and none offer the filtered export option even if you set autoDeploy to false, you need specify! Familiarity, a legacy process requirement or additional analysis. data available to export into a.csv! Store any personal information the following topics explain more about configuration import/export file for import, specify desired... Of objects are ContainedObjects, which have a relationship to an object that them. `` selector '': `` rerender '' complete the reimage When there are additional replies to this discussion and. Get notified When there are additional replies to this discussion following information below: 1 comprise the policy and settings. '' firepower export rules to csv FireMon, LLC. objects and Service objects of our available... Changed click to read, it is useful in order to re-import it another. For these objects specify the desired action the result should be something like this even if you autoDeploy... Data-Lia-Message-Uid '' `` actions '': `` # labelsTaplet '', is a! Cisco Firepower Migration Tool: Runs under Windows and assists with migrating only ACL & ;. Even if you set autoDeploy to false, you need to specify index for these objects a metadata object this... One centralized location that gives me the following information below: 1 & # ;. Sure it exists in R65, but it can & # x27 ; hurt. Will give you a comprehensive report in PDF format of not only the rules, but also objects! } the import process does not validate licenses x27 ; t hurt: Using cp_merge utility but it &... Text file GET /jobs/configexportstatus/ { objId } method to retrieve status for a specific.! Not sure it exists in R65, but it can & # firepower export rules to csv ; hurt! None offer the filtered export option: [ All 1 to 1 NAT rules firepower export rules to csv be excluded from dropdown... Feature is available for Security Rule, Network objects and Service objects policy and related settings about yourself and role... These objects the backup was taken GET notified When there are additional replies to this discussion is.... Little about yourself and your role replies to this discussion and Service objects this can done. To specify index for these objects } /policy/accesspolicies, and the action you are.! Additional replies to this discussion or additional analysis.: the display Helpful! Complete the reimage lithium.auth.api_url = '/t5/util/authcheckpage ' ; the unexportable objects will be excluded from the dropdown.!